PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00020043-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family EIL
Protein Properties Length: 447aa    MW: 50385.7 Da    PI: 4.6715
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00020043-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3179.92.4e-55401501114
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel++rmwkd+++lkr+ker+k  +  +++a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++
  WALNUT_00020043-RA  40 EELERRMWKDRIRLKRIKERQKL-V--AQQAADKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNI 127
                         8******************9996.3..34459*********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3  92 raWWkekvefdrngpaaiskyqa 114
                         raWWkekv+fd+ngpaai++++ 
  WALNUT_00020043-RA 128 RAWWKEKVKFDKNGPAAIANSDN 150
                         ********************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048738.9E-5440155No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MDHLMMVDDP LGDSSDLEVD DIRCENIAEK DVSDEEIEAE ELERRMWKDR IRLKRIKERQ  60
KLVAQQAADK QKPKQTSDQA RRKKMSRAQD GILKYMLKLM EVCKARGFVY GIIPEKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAIANSDN GASSVTDMPR RGRGENKQAA ISSESDYDVD  180
GVDDGVGSVS SKDDRRNQPA DVETSENLRN STPPVQDKDP GEKQPRRKRA RVRSNPSDQL  240
PATTHNEHLH AEPRITVPDV NDANGQLVEF QIHGGREENG TVSALRPLEK DTGDQLQLPA  300
SECNRFSDLP SDNVISTQSM YVDGRPLLHP VVQNTEMHHD DASNFYNDWQ QSQIVMNEPQ  360
IRPEEVGVIP MLDRSANEIP GGDLRYYVKD TFTNEQHRPV DSQYGSGIDS LPLDFGELNS  420
PFHLGFDSLS QFDDFLPDED LIQYFGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867129.11e-135PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231162e-65EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0B2RFK81e-157A0A0B2RFK8_GLYSO; ETHYLENE INSENSITIVE 3-like 3 protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1820556
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.14e-56ETHYLENE-INSENSITIVE3-like 3